PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0050000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 149aa    MW: 16708.1 Da    PI: 10.4181
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0050000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14e-10831162255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp+ ee+++LA+ +gL+++q+ +WF N+R ++
  Spipo6G0050000  83 WPYPTDEEKAKLAEVTGLDQKQINNWFINQRKRH 116
                     59*****************************985 PP

2ELK24.56.5e-093756221
             ELK  2 LKhqLlrKYsgyLgsLkqEF 21
                    LK+ L++KYs yL++L++E+
  Spipo6G0050000 37 LKETLMKKYSNYLSNLRKEL 56
                    9******************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011880.00163657IPR005539ELK domain
PROSITE profilePS512139.7083656IPR005539ELK domain
PfamPF037892.2E-53756IPR005539ELK domain
PROSITE profilePS5007112.56856119IPR001356Homeobox domain
SuperFamilySSF466893.25E-1958126IPR009057Homeodomain-like
SMARTSM003898.5E-1258123IPR001356Homeobox domain
CDDcd000863.12E-1260120No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2861120IPR009057Homeodomain-like
PfamPF059205.3E-1876115IPR008422Homeobox KN domain
PROSITE patternPS00027094117IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MAGRAAKGVG DASEEKLNCT DPTKKGGGGI WTGGQHLKET LMKKYSNYLS NLRKELQKNR  60
KKGNLPKGAR ALLMDWWTKH YQWPYPTDEE KAKLAEVTGL DQKQINNWFI NQRKRHWKPS  120
EGMRSTLVDG ITGGSHSTTW CFGMALGQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382394.14e-50hypothetical protein POPTR_0005s01720g
SwissprotQ7GDL59e-41KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
SwissprotA2Y0079e-41KNOSA_ORYSI; Homeobox protein knotted-1-like 10
TrEMBLU5GD074e-50U5GD07_POPTR; Uncharacterized protein
STRINGPOPTR_0005s01720.11e-49(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.14e-37KNOTTED-like from Arabidopsis thaliana